SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028698 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028698
Domain Number 1 Region: 263-613
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-65
Family p120GAP domain-like 0.00014
Further Details:      
 
Domain Number 2 Region: 570-712
Classification Level Classification E-value
Superfamily PH domain-like 7.77e-34
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 
Domain Number 3 Region: 6-127
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.52e-26
Family PLC-like (P variant) 0.098
Further Details:      
 
Domain Number 4 Region: 113-236
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.24e-26
Family Synaptotagmin-like (S variant) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028698   Gene: ENSMMUG00000021793   Transcript: ENSMMUT00000030663
Sequence length 746
Comment pep:known chromosome:MMUL_1:11:114026422:114059130:-1 gene:ENSMMUG00000021793 transcript:ENSMMUT00000030663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSSSLNVRVVEGRALPAKDVSGSSDPYCLVKVDDEVVARTATVWRSLGPFWGEEYTVH
LPLDFQQLAFYVLDEDTVGHDDIIGKISLSREAITADPRGIDSWINLSRVDPDAEVQGEI
CLSVQMLEDGRGRCLRCHVLQARDLAPRDISGTSDPFARVFWGSQSLETSTIKKTRFPHW
DEVLELREMPGAPSPLRVELWDWDMVGKNDFLGMVPLVRQGLTVLKPPNGWFRLLPFPRA
EEDSGRNLGALRVKVRLIEDRVLPSQCYQPLVELLMESVLGPAEEDTASPLALLEELTLG
DCRQDLATKLVKLFLGRGLAGPFLDYLTRREVARTMDPNTLFRSNSLASKSMEQFMKLVG
MPYLHEVLKPMISRVFEEKKYMELDPCKMDLGRTRRISFKGAPSEEQMRETSLGLLTGYL
GPIVDAIVGSVGRCPPAMRLAFKQLHRRVKERFPKPEHQNNSYYAVTHFLEPHLRAFDLC
HISLHLFQILSSFAKGNNLRFCMTVCKAVQSIGNLGQQLGQGKELWMAPLHPFLLQSVSR
VRDFLDRLVDVDGDEEAGVPARALFPPSAIVREGYLLKRKEEPAGLATRFAFKKRYVWLS
GETLSFSKSPEWQTRHSIPVSHIRAVERVDEGAFQLPHVMQVVTQDGAGALHTTYLQCKN
VNELNQWLSALRKASAPNPDKLAACHPGAFRSARWTCCLQAERSAAGCSRTHSAVTLGDW
SDPLDPDAEAQTVYRQLLLGRDQLRW
Download sequence
Identical sequences ENSMMUP00000028698 9544.ENSMMUP00000028698 ENSMMUP00000028698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]