SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028743 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028743
Domain Number 1 Region: 1033-1140
Classification Level Classification E-value
Superfamily Bromodomain 3.79e-29
Family Bromodomain 0.00064
Further Details:      
 
Domain Number 2 Region: 957-1009
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000188
Family PHD domain 0.0024
Further Details:      
 
Domain Number 3 Region: 62-111
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000101
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028743   Gene: ENSMMUG00000021827   Transcript: ENSMMUT00000030712
Sequence length 1187
Comment pep:known chromosome:MMUL_1:14:63297318:63328589:1 gene:ENSMMUG00000021827 transcript:ENSMMUT00000030712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQNCSECKEKRAAHILCTYCNRWLCSSCTEEHRHSPVSGGPFFPRAQKGSLGVNSGPGDF
TLYCPLHTQEVLKLFCETCDMLTCHSCLMVEHKEHRHVEEVLQNQRMLLESVTTQVAHKK
SSLQTSAKQIEDRIFEVKHQHRKVENQIKMAKMVLMNELNKQANGLIEELEGITNERKRK
LEQQLQSIMVLNRQFEHVQNFINWAVCSKTSVPFLFSKELIVFQMQRLLETSCNTDPGSP
WSIRFTWEPNFWTKQLASLGCITTEGGQLSRADAPAYGGLQGPSPFYQSHQSPVAQQEAL
SHPSHKFQSPAVCSSSVCCSHCSPVSPSLKGQVPPPSMHPAHNFRQPSEMVPQQLGSLQC
SALLPREKELACSPHPPKLLQPWLETQPPVEQESTSQRLGQQLTSQPVCIVPPQDVQQGT
HAQPTLQTPSIQVQFGHNQKLKLSHFQQQPQQQLPPPPPPLPAPPQQPHPPLPPSQHLAS
SQHESPPGPACSQNVDIMHHKFELEEMQKDLELLLQAQQPSLQLSQTKSPQHLQQTIVGQ
INYIVRQPAPVQSQSQEETLQGTDEPPASEGSKRALSLDKNTAAALPQASGEETPLGVPP
VDSTIQHSSPNVVRKHSTSVSIMGFSNTLEMELSSTRLERPLEPQIQSVSSLTSGAPLAV
PSLLSASPKTVSSLTSVQNQAMPSLTTSHLQTVPSLVRSTFQSMPNLMSDSSQAMASLAN
DHPQAGPSLMSGHTQAVPSLATCPLQSIPPVSDMQPETGSSSSSGRTSGSLCPGDGADPS
LGNALCKVKLEEPINLSVKKPPLAPVVSTSTALQQYRNPKECENFEQGALELDAKENKSI
RAFNSEHKIPYVRLERLKICAASSGEMPVFKLKPQKNDQDGSFLLIIECGTESSSMSIKV
SQDRLSEATQAPGLGGRKVTVTSLAGQRPSEVEGTSPEEHRLIPRTPGAKKGPPAPIENE
DFCAVCLNGGELLCCDHCPKVFHLSCHVPALLSFPGGEWVCTLCRSLTQPEMEYDCENAR
YNQPGMRASPGLSMYDQKKCEKLVLSLCCNNLSLPFHEPVSPLARHYYQIIKRPMDLSII
RRKLQKKDPAHYTTPEEVVSDVRLMFWNCAKFNYPDSEVAEAGRCLEVFFEGWLKEIYPE
KRFAQPRQEDSDSEEVSSESGCSTPQGFPWPPYVQEGIQPKRRRRHM
Download sequence
Identical sequences ENSMMUP00000028743 9544.ENSMMUP00000028743 ENSMMUP00000028743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]