SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028852 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028852
Domain Number 1 Region: 610-665
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000366
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 2 Region: 554-610
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000628
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 665-720
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000301
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 4 Region: 501-551
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000106
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 754-807
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 443-489
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000732
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028852   Gene: ENSMMUG00000021914   Transcript: ENSMMUT00000030829
Sequence length 807
Comment pep:known chromosome:MMUL_1:14:57657794:57953881:-1 gene:ENSMMUG00000021914 transcript:ENSMMUT00000030829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSLAPLKLSRTPALLALVLPLAAALAFSDETLDKVPKSEGYCSRILRAQGTRREGYTE
FSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALKENREGDKEEDHAGTFQIIDEE
ETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKK
LCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHS
KNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQPLNVRAA
PSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSG
VTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPD
NVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPC
PDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGTGMRSRERYVKQFPEDGSVCTL
PTEETEKCTVNEECSPSSCLMTEWGEWDECSATCGMGMKKRHRMIKMSPADGSMCKAETS
QAEKCMMPECHTIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSLAELGDCNEDLEQVEKC
MLPECPIDCELTEWSQWSECNKSCGKGHVIRTRMIQMEPQFGGAPCPETVQRKKCRIRKC
LRNPSIQKLRWREARESRRSEQLKEESEGEQFPGCRMRPWTAWSECTKLCGGGIQERYMT
VKKRFKSSQFTSCKDKKEIRACNVHPC
Download sequence
Identical sequences G7PQN9 H9EU02
ENSMMUP00000028852 NP_001253047.1.72884 ENSMMUP00000028852 9544.ENSMMUP00000028852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]