SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028881 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028881
Domain Number 1 Region: 702-1321
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 1.57e-196
Family Molybdenum cofactor-binding domain 0.00000000000278
Further Details:      
 
Domain Number 2 Region: 200-420
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.48e-63
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.00000548
Further Details:      
 
Domain Number 3 Region: 550-702
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 8.77e-45
Family CO dehydrogenase molybdoprotein N-domain-like 0.0000354
Further Details:      
 
Domain Number 4 Region: 100-220
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 4.58e-38
Family CO dehydrogenase ISP C-domain like 0.0000486
Further Details:      
 
Domain Number 5 Region: 423-536
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 1.44e-35
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0000542
Further Details:      
 
Domain Number 6 Region: 6-92
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.39e-23
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028881   Gene: ENSMMUG00000021931   Transcript: ENSMMUT00000030858
Sequence length 1338
Comment pep:known chromosome:MMUL_1:12:64174534:64261603:1 gene:ENSMMUG00000021931 transcript:ENSMMUT00000030858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITNRIRHHPANACLIPICSLYGTAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLHQLTDALGGNLCRCTGYRPIIDACKTFCETLGCCQSKENGVCC
LDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQPQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPQVKFKGVFHPVIISPDRIEELSFLSPC
FLRLTLGAGLSLAQVKDILADVVQKLPEEKTQTYHALLKHLGTLAGSQIRNMASLGGHII
SRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR
KLEFVSAFRQAQRQENALAIVNSGMRVFFGEGHGIIRELSISYGGVGPATICAKNSCQKL
IGRHWNEEMLDTACRLVLEEVSLSGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPI
HYPSLADKYESALEDLHSKHHCSTLKYQHMGPKQHPEDPIGHPIMHLSGVKHATGEAIYC
DDMPPVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDVITAEHLSDVNSFCFFTEAE
EFLATDKVFCVGQLVCAVLADSEVQAKQAAKQVKIVYQDLEPLILTIKEAIQHNSFFEPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVKRVGGAFGGKAFKTGVIAAVTAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGNSLDESLLVIEMGLLKMDNAYKF
PNLRCRGWACRTNLPSNTAFRGFGFPQAGLITESCIMEVAAKCGLSPEKVRMINMYKEID
QTPYKQEINAKNLIQCWRECMAVSSYSLRKAAVEKFNAENYWKKKGLAMVPLKYPVGLGS
RAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELGMPISNVHLRGTSTETV
PNANVSGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKDWAQTAFDDSISLSAVG
YFRGYESDINWEKGEGHPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGVLHTRGPDQYKIPAICDTPTEFHISLLPPSENSN
TLYSSKGLGESGVFLGCSVFFAIHDAVSAARRERGLHGPLSLNSPLTPEKIRMACEDKFT
KMIPRDEPGSCVPWNVPI
Download sequence
Identical sequences ENSMMUP00000028881 ENSMMUP00000028881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]