SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028928 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028928
Domain Number 1 Region: 328-483
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-56
Family SPRY domain 0.0000122
Further Details:      
 
Domain Number 2 Region: 31-143
Classification Level Classification E-value
Superfamily Immunoglobulin 5.49e-23
Family V set domains (antibody variable domain-like) 0.00028
Further Details:      
 
Domain Number 3 Region: 159-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000004
Family C1 set domains (antibody constant domain-like) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028928   Gene: ENSMMUG00000021969   Transcript: ENSMMUT00000030909
Sequence length 545
Comment pep:known chromosome:MMUL_1:4:26493190:26504002:1 gene:ENSMMUG00000021969 transcript:ENSMMUT00000030909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAAALHFSLPASLILLLLLRLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNA
EDMEVRWFRSQFFPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNVTAQE
NGTYRCYFQEGRSYDEAILHLVVAGLGSKPLIEMRGHEDGGIRLECISRGWYPKPLTVWR
DPYGGIVPALKEVVTPDTDGLFMVTTAVIIRDKSMRNMSCSINDTLLSQKKESVIFIPES
FMPSMSPCVVALPIIVVFLMIIIAVCIYWINRLQKETKILSGEKEFVVETREIAVKELEK
ERVQKEKELQVKESLHGNPRPKPETSSAVDVVLDPDTAHPDLLLSEDRRSVRRCPLRHLG
ESVPDNPERFDSEPCVLGRESFASGKHYWEVEVENVIEWTVGVCRDSVERKEEVLLLPQN
GFWTLDMHKGQYRALSSPKRILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSA
FSGDTSQSEDQSEPVESIPWSHSRADKPWSSQQPLHNVVEQLPAASLTPTPALSPSFLLL
TRLCF
Download sequence
Identical sequences 9544.ENSMMUP00000028928 ENSMMUP00000028928 ENSMMUP00000028928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]