SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029120 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029120
Domain Number 1 Region: 317-601
Classification Level Classification E-value
Superfamily Kelch motif 6.28e-62
Family Kelch motif 0.0000754
Further Details:      
 
Domain Number 2 Region: 51-165
Classification Level Classification E-value
Superfamily POZ domain 2.28e-30
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029120   Gene: ENSMMUG00000022115   Transcript: ENSMMUT00000031111
Sequence length 619
Comment pep:known chromosome:MMUL_1:2:103106049:103173911:1 gene:ENSMMUG00000022115 transcript:ENSMMUT00000031111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQRGAWTMGDVVEKSLEGPLAPSTDEPSQKRGDLVEILNGEKVKFDDAGLSLFLQNGL
ETVRLEDALTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDAET
MHTLLDYTYTSKALITKQNVQRVLEAANLFQFLRMVDACASFLTEALNPENCVGILRLAD
THSLDSLKKQVQSYIIQNFVQILNSEEFLDLPVDTLHHILKSDDLYVTEEAQVFETVMSW
VRHKPSERLCLLPYVLENVRLPLLDPWYFVETVEADPLIRQCPEVFPLLQEARMYHLSGN
EIISERTKPRMHEFQSEVFMIIGGCTKDERFVAEVTCLDPLRRSRLEVAKLPLTEHELES
ENKKWVEFACVTLKNEVYISGGKETQHDVWKYNSSINKWIQIEYLNIGRWRHKMVVLGGK
VYVIGGFDGLQRINNVETYDPFHNCWSEAAPLLVHVSSFAATSHKKKLYVIGGGPNGKLA
TDKTQCYDPSTNKWSLKAAMPVEAKCINAVSFRDRIYVVGGAMRALYAYSPLEDSWCLVT
QLSHERASCGIAPCNNRLYITGGRDEKNEVIATVLCWDPEAQKLTEECVLPRGVSHHGSV
TIRKSYTHIRRIVPGAVSV
Download sequence
Identical sequences 9544.ENSMMUP00000029120 ENSMMUP00000029120 ENSMMUP00000029120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]