SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029228 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029228
Domain Number 1 Region: 322-533
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.16e-44
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 182-320
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 8.24e-42
Family Domain of poly(ADP-ribose) polymerase 0.00012
Further Details:      
 
Domain Number 3 Region: 43-154
Classification Level Classification E-value
Superfamily WGR domain-like 1.31e-37
Family WGR domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029228   Gene: ENSMMUG00000022203   Transcript: ENSMMUT00000031229
Sequence length 534
Comment pep:known chromosome:MMUL_1:2:84449910:84454945:-1 gene:ENSMMUG00000022203 transcript:ENSMMUT00000031229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMAPKRKCSVQTEGPEKKKGRQGGREEDPFRSTAEALKAMPAEKHIIRVDPTCPLSSNPE
TQVHEDYDCTLNQTNIGNNNNKFYIMQLLQDGQHFTCWNRWGRVGEVGQSKINHFTRLED
AKKDFEKKFREKTKNKWAERDRFVAHPGKYTLIEVQGEDEAQEAVVKVDGGPVRTVAKRV
QPCSLDPATQKLVTNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEAL
KGPTDGGQSLEELSSHFYTVIPHNFGRSRPPPINSPELLQAKKDMLLVLADIELAQALQA
APEQEKMVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVSLGHTSEQQGKAPECLGGRTPI
SHFLSTQEDRFQAHSKLGNRKLLWHGTNTAVVAAILTSGLRIMPHSGGRVGKGIYFASEN
SKSAGYVTGMNCGAHHIGYMFLGEVALGREHHITTDKPSLKSPPPGFDSVIARGHTEPDP
TQDTELELDGQRVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVRL
Download sequence
Identical sequences 9544.ENSMMUP00000029228 ENSMMUP00000029228 ENSMMUP00000029228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]