SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029252 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029252
Domain Number 1 Region: 930-1205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.48e-71
Family Tandem AAA-ATPase domain 0.0000316
Further Details:      
 
Domain Number 2 Region: 735-928
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-41
Family Tandem AAA-ATPase domain 0.00018
Further Details:      
 
Domain Number 3 Region: 471-518,545-591
Classification Level Classification E-value
Superfamily Chromo domain-like 5.95e-17
Family Chromo domain 0.019
Further Details:      
 
Domain Number 4 Region: 611-684
Classification Level Classification E-value
Superfamily Chromo domain-like 2.36e-16
Family Chromo domain 0.0059
Further Details:      
 
Domain Number 5 Region: 369-425
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.43e-16
Family PHD domain 0.0016
Further Details:      
 
Domain Number 6 Region: 159-198
Classification Level Classification E-value
Superfamily HMG-box 0.0000782
Family HMG-box 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029252   Gene: ENSMMUG00000022221   Transcript: ENSMMUT00000031257
Sequence length 1960
Comment pep:known chromosome:MMUL_1:16:7638506:7662748:1 gene:ENSMMUG00000022221 transcript:ENSMMUT00000031257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKEN
KPGKPRKRKKRDSEEEFGSERDEYREKSESGGSEYGTGPGRKRRRKHREKKEKKTKRRKK
GEGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKI
PMSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSAAVSSATPIAPSGPP
ALPPPPAADIQPPPIRRAKTKEGKGPGHKRRSKSPRVPDGRKKLRGKKMAPLKIKLGLLG
GKRKKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRGRPGRKKKKVL
GCPAVAGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSC
PHCEKEGVQWEAKEEEEEYEEEGEEEGEKEEEDDHMEYCRVCKDGGELLCCDACISSYHI
HCLNPPLPDIPNGEWLCPRCTCPVLKGRVQKILHWRWGEPPVAMPAPQQADGNPDVPAPR
PLQGRSEREFFVKWVGLSYWHCSWAKELQLEIFHLVMYRNYQRKNDMDEPPPLDYGSGED
DGKSDKRKVKDPHYAEMEEKYYRFGIKPEWMTVHRIINHSVDKKGNYHYLVKWRDLPYDQ
STWEEDEMNIPEYEEHKQSYWRHRELIMGEDPAQPRKYKKKKKELQGDGPPSSPTNDPTV
KYETQPRFITATGGTLHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLYK
EDSRAIIRENEFSFEDNAIKGGKKAFKMKREAQVKFHVLLTSYELITIDQAALGSIRWAC
LVVDEAHRLKNNQSKFFRVLNGYKIDHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEG
FLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKYI
LTRNFEALNSRGGGNQVSLLNIMMDLKKCCNHPYLFPVAAMESPKLPSGAYEGGALIKSS
GKLMLLQKMLRKLKEQGHRVLIFSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAI
DRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKV
MIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKD
ENEGENKEEDSSVIHYDNEAIARLLDRNQDATEDTDVQNMNEYLSSFKVAQYVVREEDKI
EEIEREIIKQEENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRVRKQVNYNDAAQEDQDN
QSEYSVGSEEEDEDFDERPEGRRQSKRQLRNEKDKPLPPLLARVGGNIEVLGFNTRQRKA
FLNAVMRWGMPPQDAFTTQWLVRDLRGKTEKEFKAYVSLFMRHLCEPGADGSETFADGVP
REGLSRQQVLTRIGVMSLVKKKVQEFEHINGRWSMPELMPDPSADSKRSSRASSPTKTSP
TTPEASATNSPCTSKPATPAPSEKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMDTEVDA
PSPAPSLGERLEPRKIPLEDEVPGVPGEMELEPGYRGDREKSATESTPGERGEEKPMDGQ
EHRERPEGEAGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTEL
HTLWQNEERAAISSGKLNEIWHRRHDYWLLAGIVLHGYARWQDIQNDAQFAIINEPFKTE
ANKGNFLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNLSQEPAHPAMALHARFAEAECL
AESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPATLSRIPPIAARLQMS
ERSILSRLASKGTEPHPTPAFPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFI
TAATNGPPVLVKEKEMVGALVSDGLDRKEPRAGEVICIDD
Download sequence
Identical sequences ENSMMUP00000029252 ENSMMUP00000029252 9544.ENSMMUP00000029252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]