SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029253 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029253
Domain Number 1 Region: 356-625
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.49e-71
Family Tandem AAA-ATPase domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 95-354
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.99e-55
Family Tandem AAA-ATPase domain 0.000049
Further Details:      
 
Domain Number 3 Region: 2-66
Classification Level Classification E-value
Superfamily Chromo domain-like 1.26e-16
Family Chromo domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029253   Gene: ENSMMUG00000016838   Transcript: ENSMMUT00000031258
Sequence length 1377
Comment pep:known chromosome:MMUL_1:1:9101838:9148113:-1 gene:ENSMMUG00000016838 transcript:ENSMMUT00000031258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERFYRYGIKPEWMMIHRILNHSFDKKGDVHYLIKWKDLPYDQCTWEIDDIDIPYYDNL
KQAYWGHRELMLGEDTRLPKRLLKKGKKLRDDKQEKPPDTPIVDPTVKFDKQPWYIDSTG
GTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAP
LSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRSGKKVFRMKKEVQI
KFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGT
PLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVF
KNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPY
LFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLE
DFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVII
YDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGL
GSKSGSMTKQELDDILKFGTEELFKDDVEGMMSQGQRPVTPIPDVQSSKGGNLAASAKKK
HGSTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVRE
EDGVEEVEREIIKQEENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQE
DQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRDKPLPPLLARVGG
NIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCE
PGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYSTPDLISEGPEGK
KPGEVISSDPNTPVPASPAHLPPAPLSLPDKMEAQLGYMDEKDPGMQKPKKPLEVQALPA
ALDRVEGEDKHESPASKERAREERPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIH
SRGDGSELRPDDTKAEEKEPIETQQNGDKEEDDEGKKEDKKGKFKFMFNIADGGFTELHT
LWQNEERAAVSSGKIYDIWHRRHDYWLLAGIVTHGYARWQDIQNDPRFMILNEPFKSEIH
KGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPNHPAMALNARLAEVECLAE
SHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIPPVAARLQMSER
SILSRLTNRAGDPTIQQGAFGSSQMYSNNFGPNFRGPGPGGIVNYNQMPLGPYVTDI
Download sequence
Identical sequences ENSMMUP00000022145 9544.ENSMMUP00000022145 ENSMMUP00000029253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]