SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029286 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029286
Domain Number 1 Region: 28-149
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.35e-27
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029286   Gene: ENSMMUG00000022248   Transcript: ENSMMUT00000031295
Sequence length 317
Comment pep:known chromosome:MMUL_1:8:138072494:138195679:1 gene:ENSMMUG00000022248 transcript:ENSMMUT00000031295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIEKFQKGEGKDEEKYIDVVINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQE
ETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALE
EIKKFLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRGKPTLRTRGVPAPAITRGRGGV
TTRPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEY
DYDDGYGTAYDEQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAP
SARTAKGVYRDQPYGRY
Download sequence
Identical sequences ENSMMUP00000029286 ENSMMUP00000029286 9544.ENSMMUP00000029286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]