SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029293 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029293
Domain Number 1 Region: 148-465
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.45e-123
Family Transglutaminase core 0.00000000946
Further Details:      
 
Domain Number 2 Region: 5-147
Classification Level Classification E-value
Superfamily E set domains 8.4e-45
Family Transglutaminase N-terminal domain 0.00019
Further Details:      
 
Domain Number 3 Region: 608-705
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.28e-25
Family Transglutaminase, two C-terminal domains 0.00063
Further Details:      
 
Domain Number 4 Region: 487-606
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.78e-24
Family Transglutaminase, two C-terminal domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029293   Gene: ENSMMUG00000022251   Transcript: ENSMMUT00000031302
Sequence length 710
Comment pep:known chromosome:MMUL_1:7:21718880:21743178:-1 gene:ENSMMUG00000022251 transcript:ENSMMUT00000031302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQVATLQLESVDLQSSGNNREHHTQEMGVKRLTVRRGQLFYLRLSFSRPFQSQSDHITF
VAETGPKPSELLGTRATFFLTRVRPGNVWSASDFTIDSNSLHVSLFTPANAVIGHYILKI
EISQGQGHSVTYPLGTFILLFNPWSPEDDVYLPSEILLQEYVMQDYGFVYKGHERFITSW
PWNYGQFEEDIIDICFEILNKSLHYLKNPAKDCSQRNDVVYVCRVVSAMINSNDDNGVLQ
GNWSEDYSEGVSPLEWNGSVAILRQWSARGGQPVKYGQCWVFASVMCTVMRCLGVPTRVV
SNFRSAHNVDRNLTIDTYYDRNAEMLSTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVL
DPTPQQTSSGLFCCGPASVKAIREGDVHLAYDTPFVYAEVNADEVIWLLRDGQAQEILAH
NTSSIGKEISTKMVGSDQHQSITSSYKYPEGSPEERAVFMKASRKMLGPQRASSPFLDLL
ESGGLRDEPAQLQLHLARTPEWGQDLQLLLRIRRVPDSTHPQGPIGLLVRFCAQALLHGG
GPRKPLWRHTVRVNLDFGKETQRPLLLPYSNYRSKLTDEKLIRVSGIAEVEETGRSMLVL
KDISLEPPHLSIEVSERAEVGKALRVHVTLTNTLMVALSSCTMVLEGSGLVNGQITKDLG
TLVAGHTLQIQLDLYPTKAGPRQLQVLISSNEVKEIKGYKDIFVTAAGAP
Download sequence
Identical sequences F6YVG4
9544.ENSMMUP00000029293 ENSMMUP00000029293 ENSMMUP00000029293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]