SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029299 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029299
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.85e-130
Family Transglutaminase core 0.00000000697
Further Details:      
 
Domain Number 2 Region: 3-145
Classification Level Classification E-value
Superfamily E set domains 7.35e-41
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 618-716
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.67e-27
Family Transglutaminase, two C-terminal domains 0.00021
Further Details:      
 
Domain Number 4 Region: 506-617
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.45e-27
Family Transglutaminase, two C-terminal domains 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029299   Gene: ENSMMUG00000022256   Transcript: ENSMMUT00000031309
Sequence length 719
Comment pep:known chromosome:MMUL_1:7:21674520:21701705:-1 gene:ENSMMUG00000022256 transcript:ENSMMUT00000031309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAGLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFNLTLYFRNRGFQPGLDNIIFVV
ETGPLPDLALGTRAVFSLARHHSPSPWIAWLETNGATSTEVSLCAPPTAAVGRYLLKIHI
DSFQGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPCPW
NYGQFEEKIIDICLKLLDKSLHFQTDPATDCALRGSPVYVSRVVCAMINSNDDNGVLNGN
WSENYTDGANPAEWTGSVAILKQWYATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVITN
FDSGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLPPGYGGWQVLDA
TPQEMSNGVYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDTS
SVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKAGSFHSSQRGAELQPS
RPTPLSRDSPRNLHTPSLRPSDVVQVSLKFKLLDPPNMGQDICFVLLALNVSSQFKDLKV
NLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALGE
EKSSPEKILVNKIITLSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVLTVEGSG
LFKKQQKVLLGVLKPQHRASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Download sequence
Identical sequences ENSMMUP00000033747 9544.ENSMMUP00000033747 ENSMMUP00000029299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]