SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029342 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029342
Domain Number 1 Region: 40-295
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-92
Family Protein kinases, catalytic subunit 0.0000108
Further Details:      
 
Domain Number 2 Region: 669-777
Classification Level Classification E-value
Superfamily KA1-like 5.89e-47
Family Kinase associated domain 1, KA1 0.00000544
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029342
Domain Number - Region: 305-353
Classification Level Classification E-value
Superfamily UBA-like 0.00239
Family UBA domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029342   Gene: ENSMMUG00000022288   Transcript: ENSMMUT00000031359
Sequence length 777
Comment pep:known chromosome:MMUL_1:1:149671757:149735175:-1 gene:ENSMMUG00000022288 transcript:ENSMMUT00000031359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HTSVDGYTEPHIQPTKSSSRQNIPRCRNSITSATDEQPHIGNYRLQKTIGKGNFAKVKLA
RHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIDGVSLFIETEKTLYLVME
YASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKCIVHRDLKAENLLLDGDMNIK
IADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPF
DGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEE
EELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRKPPEFEG
GESSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQRRFSDHAGPSIPPAVSYTK
RAQANSVESEQKEEWDKDVARKLGSTTVGSKSEMTASPLVGPERKKSSTIPSNNVYSGGS
MARRNTYVCERTTDRYTALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTS
GHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQ
LRERRSAAYNGPPASPSHETGAFAHARRGTSTGIISKITSKFVRRDPSEGEASGRTDTSR
STSGEPKERDKEEGKDSKPRSLRFTWSMKTTSSMDPNDMMREIRKVLDANNCDYEQKERF
LLFCVHGDARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Download sequence
Identical sequences ENSMMUP00000029340 ENSMMUP00000029342 9544.ENSMMUP00000029340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]