SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029346 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029346
Domain Number 1 Region: 216-343
Classification Level Classification E-value
Superfamily Second domain of FERM 1.16e-31
Family Second domain of FERM 0.002
Further Details:      
 
Domain Number 2 Region: 347-448
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-25
Family Third domain of FERM 0.0032
Further Details:      
 
Domain Number 3 Region: 2-78
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000546
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 127-178
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000496
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029346   Gene: ENSMMUG00000022293   Transcript: ENSMMUT00000031363
Sequence length 1642
Comment pep:known chromosome:MMUL_1:X:106236991:106316849:1 gene:ENSMMUG00000022293 transcript:ENSMMUT00000031363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQVTVHRDPIYGFGFVAGSERPVVVRSVRPGGPSENKLLAGDQIVAINEEDVSEAPRERL
IELIRSAKEFIVLTVLHTHQSPKSAFISAAKKAKLRSNPVKVRFSEQVAVGETDAKMMKK
EALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMVTLQDRLSLRYIEHFALVLEYAGPEQ
NHKFLLLQDKQPLAYVVQRTHYHGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQSRNDV
IRERFGMDPKPEMLLGLAALHIYITVSTTRPSQKISLKNVEKEWGLEPFLPPSLLQGIKE
KNLRKSLSQQLKAHQTHPSCGTKGSAIQAKLQYLRILNELPTFTGVLFNTVGLDEKQSAT
TLLVGPRHGISHVIDLKTNLTTVLSEFSKISKIQLFRENQGVARVETSIMDAKPLVLLME
WPEATNFACLIAGYCRLLLDSRKMVFSRPASQPLPPPMIKADYMHSAHRPVTGGHLGKKE
SSYVGSVGTSPRKSSRCTPPPADSELVSFCYLHMREQRKEQESRTDVNENLIFFEETRPR
TKSDPTSKSSGQGYEVVPDDFDAASLDHEPCASRARSYTLDNSLGADALNFYCDSCKAKL
QEQLGPRKGGKPGSSRDNIVDLMSLPPPGSEEEEEEEDETTSLLPAIAAPPPGFRDNSSD
EDDPKRRAVQSQEQGRHLRGLLYDEIPVTLIDSVQTRTVRDHAQELDDALVSTLQALEAL
AASEDGPHPPPPQTAGLIVLATITPESSLDSGHETNSSELTDMSEMMSAMKQHQNTTYFL
AQHLNKDSLLARKDLPFRIQSCAAQAVLTAPYSLGRPDPNPSLQPIATGQSTGPTGARRK
LPQSEGQVQGERTYSLAVHPALSPQLSEQKNLSLLSPVPEDKGPGHTRAGLEMSLRAATS
SLSEEQVSELRDNLPKEVRLSPKLILDPKGSVTPAIISAALQQVVHSKSLVTPGGALGNP
PSRGERRLEASMGRPEVSMMSSSANKNLKFKISPSAPETSRNSQHQLGAEVSSSPRAPTG
SWAESLHLSQREDRLPVQNFPPKSYLLRTSRESVGKQATGDMAGKGGPEGGKPTLQKQGT
ISSQGEKAQLESTPKRSKLEETSLVPRATYSMALQSPSCQSRSHSPSCQPHGHSPSSQSR
GQSPSCQPRGQSPLRSQAASRQVSTMPSRKLETTLNGAHSTSEGPAKPKSPSQRQPEAGP
GVSFSSPINVRRIRSTSLSRECRSDPESGVSCLTTCASGGECLGAPNYRKLMRRYSISEL
DQGDRASLTSDVYPHPPLGMLPREAKELEASLPIALGPKSRSLESPTLGDPSYVQVAPET
KGPRQMAVFSLPAEVYRKPAELDEDSESSKCCSIRYCFYYRKCDMADDASDGKDELSYSI
PMKILPGMKLDEQVVPVVSRTLQVLDAATCSSSSPEASRTQEIDLRVSTFEGSLAKINAL
RAHAYGLPDGFLAARLDTNELLTVLRQCVASPEARAPKPYVSQISEYKLELALKFKELRA
SCRRVANVDKSPTHMLAAITGSFQVLSSLIETFVRLVFIVRSEAQRQELLAKVEEVVRNY
TFLLRAAEESTARNLNQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQVAAAAGAATEHP
PGSPTSATVMSTFTHSLKTLIK
Download sequence
Identical sequences 9544.ENSMMUP00000029346 ENSMMUP00000029346 ENSMMUP00000029346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]