SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029505 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029505
Domain Number 1 Region: 23-100
Classification Level Classification E-value
Superfamily Saposin 1.12e-17
Family NKL-like 0.0046
Further Details:      
 
Domain Number 2 Region: 125-203
Classification Level Classification E-value
Superfamily Saposin 1.01e-16
Family NKL-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029505   Gene: ENSMMUG00000022418   Transcript: ENSMMUT00000031533
Sequence length 241
Comment pep:known chromosome:MMUL_1:5:1358841:1359563:1 gene:ENSMMUG00000022418 transcript:ENSMMUT00000031533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGVPSLELGLPRKQSEIQMKAGMTCEVCMSVVQKLDHWLMSNSSELMITHALERVCSVM
PASIRKECIILVDTYSPSLVQLVAKITPEKVCRFIRLCGNRRRSRALPDAYAVMPSPEWD
AENQGSFCNGCKRLLTVSSHNLESKSTKRDILMAFKGACSILPLPYMIQCKHFVTQYEPV
LIESLKDMVDPVAVCKKVGACHGPRTPLLGTDQCALGPSFWCRSQEAAKLCNTVQHCQKH
V
Download sequence
Identical sequences ENSMMUP00000029505 ENSMMUP00000029505 9544.ENSMMUP00000029505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]