SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029595 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029595
Domain Number 1 Region: 271-330
Classification Level Classification E-value
Superfamily FF domain 1.44e-16
Family FF domain 0.0000756
Further Details:      
 
Domain Number 2 Region: 485-557
Classification Level Classification E-value
Superfamily FF domain 0.00000000000133
Family FF domain 0.0048
Further Details:      
 
Domain Number 3 Region: 402-477
Classification Level Classification E-value
Superfamily FF domain 0.00000000000706
Family FF domain 0.0039
Further Details:      
 
Domain Number 4 Region: 626-686
Classification Level Classification E-value
Superfamily FF domain 0.000000000196
Family FF domain 0.0002
Further Details:      
 
Domain Number 5 Region: 97-129
Classification Level Classification E-value
Superfamily WW domain 0.00000000195
Family WW domain 0.00098
Further Details:      
 
Domain Number 6 Region: 138-168
Classification Level Classification E-value
Superfamily WW domain 0.00000000988
Family WW domain 0.0015
Further Details:      
 
Domain Number 7 Region: 335-404
Classification Level Classification E-value
Superfamily FF domain 0.000000502
Family FF domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029595   Gene: ENSMMUG00000022495   Transcript: ENSMMUT00000031635
Sequence length 871
Comment pep:known chromosome:MMUL_1:11:46764327:46785110:1 gene:ENSMMUG00000022495 transcript:ENSMMUT00000031635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPPPFMPPPGIPPPFPPMGLPPMSQRPPAIPPMPPGILPPMLPPMGAPPPLTQIPGMVP
PMMPGMLMPAVPVTAATAPGADTASSAVAGTGPPRALWSEHVAPDGRIYYYNADDKQSVW
EKPSVLKSKAELLLSQCPWKEYKSDTGKPYYYNNQSKESRWTRPKDLDDLEVLVKQEAAG
KQQQQLPHTLQPQPPQPQPDPPPAPPGPTPVPTGLLEPEPGGSEDCDVSEATQPLEQGFL
QQLEEGPSSSGQHQPQQEEEESKPEPERSGLSWSNREKAKQAFKELLRDKAVPSNASWEQ
AMKMVVTDPRYSALPKLSEKKQAFNAYKAQREKEEKEEARLRAKEAKQTLQHFLEQHERM
TSTTRYRRAEQTFGDLEVWAVVPERDRKEVYDDVLFFLAKKEKEQAKQLRRRNIQALKSI
LDGMSSVNFQTTWSQAQQYLMDNPSFAQDHQLQNMDKEDALICFEEHIRALEREEEEERE
RARLRERRQQRKNREAFQTFLDELHETGQLHSMSTWMELYPAVSTDVRFANMLGQPGSTP
LDLFKFYVEELKARFHDEKKIIKDILKDRGFCVEVNTAFEDFAHVISFDKRAAALDAGNI
KLTFNSLLEKAEAREREREKEEARRMRRREAAFRSMLRQAVPALELGTAWEEVRERFVCD
SAFEQITLESERIRLFREFLQVLEQTECQHLHTKGRKHGRKGKKHHRKRSHSPSGSESEE
EELPPPSLRPPKRRRRNPSESGSEPSSSLDSVESGGAALGGRGSPSSHLLGAGKHLEAGE
LLSQTERMPSASPSSFEGRLDWEGCTCGKAGEGKPDNSSEHELRQAELPFRSPGFGIKKE
KTGWDTSESELSEGELERRRRTLLQQLDDHQ
Download sequence
Identical sequences ENSMMUP00000029595 ENSMMUP00000029595 9544.ENSMMUP00000029595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]