SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029680 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029680
Domain Number 1 Region: 70-126
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.23e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029680   Gene: ENSMMUG00000022546   Transcript: ENSMMUT00000031724
Sequence length 197
Comment pep:known chromosome:MMUL_1:10:33870140:33876671:-1 gene:ENSMMUG00000022546 transcript:ENSMMUT00000031724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGLEAARRGPGPGGGRRAG
GGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIA
HLANVLLLGDSADDGQPCFRAAGSAKSAVPTAADGGRQPRSICTFCLSNQRKGGGRRDLG
GSCLKVRGVAPLRGPRR
Download sequence
Identical sequences A0A0D9RDK4 A0A2K5VL95 A0A2K6DRP7 F6Y9N4
ENSMMUP00000029680 XP_001107968.2.72884 XP_005568645.1.63531 XP_007961221.1.81039 XP_011764550.1.29376 ENSMMUP00000029680 9544.ENSMMUP00000029680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]