SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029688 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029688
Domain Number 1 Region: 131-456
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.28e-58
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000152
Further Details:      
 
Domain Number 2 Region: 462-595
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.99e-22
Family Ricin B-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029688   Gene: ENSMMUG00000022555   Transcript: ENSMMUT00000031733
Sequence length 598
Comment pep:known chromosome:MMUL_1:3:56328216:56931181:1 gene:ENSMMUG00000022555 transcript:ENSMMUT00000031733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
Download sequence
Identical sequences A0A096NFF7 A0A2J8T1X0 A0A2K5H9V5 A0A2K5VN50 A0A2K6M1Z9 A0A2K6P199 F6Y9A8 G3QSQ1 Q2L4S5 Q6IS24
NP_001252818.1.72884 NP_071924.1.87134 NP_071924.1.92137 XP_004045583.1.27298 XP_005549479.1.63531 XP_008016487.1.81039 XP_010375108.1.97406 XP_011787519.1.43180 XP_011848262.1.47321 XP_017750691.1.44346 ENSP00000329654 9544.ENSMMUP00000029688 9606.ENSP00000329654 ENSP00000329654 ENSMMUP00000029688 ENSMMUP00000029688 gi|22538495|ref|NP_071924.1| ENSP00000329654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]