SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029711 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029711
Domain Number 1 Region: 180-355
Classification Level Classification E-value
Superfamily Kelch motif 4.18e-29
Family Kelch motif 0.015
Further Details:      
 
Domain Number 2 Region: 9-197
Classification Level Classification E-value
Superfamily Kelch motif 6.28e-27
Family Kelch motif 0.0087
Further Details:      
 
Domain Number 3 Region: 356-398,637-781
Classification Level Classification E-value
Superfamily Fibronectin type III 1.15e-23
Family Fibronectin type III 0.00000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029711   Gene: ENSMMUG00000022571   Transcript: ENSMMUT00000031756
Sequence length 792
Comment pep:known chromosome:MMUL_1:11:105182481:105221722:1 gene:ENSMMUG00000022571 transcript:ENSMMUT00000031756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWF
LPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPS
GLPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIP
VTKGVVPSPRESHTAVIYCKKDSGGPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGT
VPLPRSLHTASVIGNKMYIFGGWVPHKGENTETSPHDCEWRCTSSFSYLNLDTTEWTTLV
SDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAP
SQVQLIKATTNSFHVKWDEVSTVEGYLLQLSTDLPYQAASSDSSAAPNMQGVRMDPHRQG
SNNIVPNSINDTINSTKTEQPATKETSMKNKPDFKALTDSNAILYPSLASNASNHNSHVV
DMLRKNEGPHTSANVGVLSSCLDVRTVIPETSVSSTVSSTQTMVTQQTIKTESSSTNGAV
VKDETSLTTFSTKSEVDETYALPATKISRVETHATAMPFSKETPSNPVATMKAGERQWCD
VGIFKNNTALVSQFYLLPKGKQSISKVGNADVPDYSLLKKQDLVPGTGYRFRVAAINGCG
IGPFSKISEFKTCIPGFPGAPSAVRISKNVEGIHLSWEPPTSPSGNILEYSAYLAIRTAQ
IQDNPSQLVFMRIYCGLKTSCTVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQVR
WLQGNNKKAPLN
Download sequence
Identical sequences A0A096NGK6 A0A2K5TKP6 F6ZF51
ENSMMUP00000029711 ENSMMUP00000029711 NP_001248661.1.72884 XP_005572122.1.63531 9544.ENSMMUP00000029711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]