SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029763 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029763
Domain Number 1 Region: 135-254
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.29e-26
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000366
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029763
Domain Number - Region: 274-296
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000314
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029763   Gene: ENSMMUG00000022606   Transcript: ENSMMUT00000031812
Sequence length 637
Comment pep:known chromosome:MMUL_1:14:9678111:9692274:1 gene:ENSMMUG00000022606 transcript:ENSMMUT00000031812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIED
LTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALN
PDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGK
GSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLR
KMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP
QSAQDKARMDKEYLSLMAELGEAPVPASVGSTGPATTPLASAPRPAAPANNPPPPSLMST
TQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGPP
PPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPP
PPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQNTTTTTTSAGTGSI
PPWQQQQAAAAASPGAPQMQGNPTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMIPPRG
GDGPSHESEDFPRPLVTLPGRQPQQRPWWTGWFGKAA
Download sequence
Identical sequences ENSMMUP00000029763 9544.ENSMMUP00000029762 ENSMMUP00000029762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]