SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029765 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000029765
Domain Number - Region: 116-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0178
Family FCH domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029765   Gene: ENSMMUG00000022607   Transcript: ENSMMUT00000031814
Sequence length 599
Comment pep:known chromosome:MMUL_1:2:87192336:87257481:-1 gene:ENSMMUG00000022607 transcript:ENSMMUT00000031814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFNVWNIKEMLSIPSGSGNKKLSNWNNNQNDYSSLSDSQFLFGSQFCPENSETLSAPLD
FGAHLRHSKQSQQNSLEGEPSIFTKYQTKPQLFGGDIKDGGLFPPPLSVGKSKGLLEQFE
EKKKRAKDKYDSETLYNFVSNVRESIHRLQTSVEKSEEHLSSRSQSILDSLETVAKTLQE
TVQAQNDLVFEAVQDKGNMEQAILEMKKRSEARQAEFIEMKSNLKHLEVLVAQQSQEFQQ
LCEQLGQLNVPSVLAELKRLISVPPVPGHVKDSASQTSPPLAQSLNLTGQEKYNFEKPVL
WQAQALPAAWNPGMGSLQPGEFGVWGEGAKNDALQEEAALPAFGSHERNRHVKDKAVQTN
CKNWAVTKTDAKNCGSSIQGHKIPSDRDLVSQGASQLTSLEINNFSTSIKNACQKYQAQS
MFLCDPREHLVTKQKDRTEEMQGKDKKQQPRKAHRAHRGRLLARKQKQIPNQTSKFNSKY
QSPQPAISVPQRPFLGQQEPHAQPLHLQYPRSPRKPVFPILGGTVMPNKTARAVQGRLLQ
FSRCSSQDNRLLSSSSQGDHQMSWFSDLNLGCSETPLCKEAGKNLLYDLGFDSSDDDGF
Download sequence
Identical sequences ENSMMUP00000029765 XP_002802826.1.72884 ENSMMUP00000029765 9544.ENSMMUP00000029765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]