SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029775 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029775
Domain Number 1 Region: 372-517
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-26
Family MAM domain 0.0012
Further Details:      
 
Domain Number 2 Region: 67-181
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000738
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 192-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029775   Gene: ENSMMUG00000022615   Transcript: ENSMMUT00000031824
Sequence length 526
Comment pep:known chromosome:MMUL_1:X:11301806:11347859:1 gene:ENSMMUG00000022615 transcript:ENSMMUT00000031824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SARHHGLLASAHQPGVCHYGTRLACCYGWRRNSKGVCEGNFLSFPRLGSNIPHLEFTFPC
FLNVPADVNECGMKPRPCQHRCVNTHGSYKCFCLSGHMLMPDATCVNSRTCAMTNCQYGC
EDTEEGPQCLCPSSGLLLAPNGRVCLDIDECASGKAICPYNRRCVNTFGSYYCKCHTGFE
LQYISGRYDCMDINECTMDSHTCSHHANCFNTQGSFKCKCKQGYKGNGLRCSAIPQNSVK
EVLRAPGTIKDRIKKLLAHKNSMKKKVKIKNVTPEPTSTPTPKVNLQPFNYEDSVSRGGN
SHGDKKGNEEKMKEGLEEEKREEKALKNDIEERSLRGDVFFPKVNEAGEFGLVLVQRKAL
TSKLEYKDLNISVDCSFDHGICDWKQDREDDFDWNPADRDNAIGYYMAVPALAGHKKDIG
RLKLLLPDLQPQSNFCLLFGYRLAGDKVGKLRVFVKNSNNALAWEETTSEDEKWKTGKIQ
LYQGTDATKSIVFEAERGKGKTGEIAVDGVLLVSGLCPDSLLSVDD
Download sequence
Identical sequences 9544.ENSMMUP00000029775 ENSMMUP00000029775 ENSMMUP00000029775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]