SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029828 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029828
Domain Number 1 Region: 420-709
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-51
Family Tandem AAA-ATPase domain 0.00025
Further Details:      
 
Domain Number 2 Region: 784-922
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.61e-31
Family RecQ helicase DNA-binding domain-like 0.000000435
Further Details:      
 
Domain Number 3 Region: 980-1065
Classification Level Classification E-value
Superfamily HRDC-like 6.92e-20
Family HRDC domain from helicases 0.0000121
Further Details:      
 
Domain Number 4 Region: 5-61
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000398
Family DnaQ-like 3'-5' exonuclease 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029828   Gene: ENSMMUG00000022655   Transcript: ENSMMUT00000031879
Sequence length 1265
Comment pep:known chromosome:MMUL_1:8:31327951:31433154:1 gene:ENSMMUG00000022655 transcript:ENSMMUT00000031879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKCTETWSLSGLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLE
ILDDAVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPDAFSKLENPQRVSILLKDI
SENLYSLRKMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIGEHKIFINVEDETWD
PTLDHLAKHGGEDVLGNKVERKEDGFEEGVEDNKLKENVERACLMSLDITEHELQILEQQ
AQEKYLSDIAYKSTEHLSPTNNENDTSYVIESDEDLEMEMLKHLSPTNNENDTSYVIESD
EDLEMEMLKSLENLNSGTVEPTHSKCLDMERNLGLPTKEEEDDENEANEEEEDDDKDSLL
PAPNEEQVTCLKMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGYGKSLCFQYPPVYVG
KIGLVISPLISLMEDQVLQLKMSNIPTCFLGSAQSENVLTDIKLGKYRIVYITPEYCSGN
IGLLQQLEADIGITLIAVDEAHCISEWGHDFRNSFRKLGSLKTALPMVPIVALTATATSS
IREDIVRCLNLRNPQIICTGFDRPNLYLEVRRKTGNILQDLQPFLVKTTSSHWEFEGPTI
IYCPSRKMTEQVTAELRKLNLSCETYHAGMSFSRRKDVHHKFVRDEIQCVIATIAFGMGI
NKADIRQVIHYGAPKEMESYYQEIGRAGRDGLQSSCHILWAPADINLNRHLLTEIRNEKF
RLYKLKMMAKMEKYLHSSRCRRQIILSHFEDKQVQKASLGITGTEKCCDNCRSRLGHCYS
MDDSEDTSWDFGPQAFQLLSAVDILGGKFGIGLPILFLRGSNSQRLADQYRKHSLFGTGK
DQTESWWKAFSRQLIIEGFLVEVSGSNKFIKICTLTEKGRNWLHKANRESQSLILQANEE
LCPKKFLLPSSRTVSSGTKEHSYNQVPVELTAEKKSNLEKLYSYKPCDKVSSGSNISKKS
IMVQAPEKSYSSSEPVISAQEQETQTVLYGKLVEARQKHANKMDVPPAILATNKILVDMA
KMRPTTVENIKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTEPQEEQKMSLVA
KNKICTLSQSMAITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLHLERAGL
TPEVQKIIADVIQNPPINSDMSKINLIRMLVPENIDTYLIHMAIAILKHGTDSRLQPSCD
VNKRRYFPSSEEISSSSKRSKEEVGINTKLTSSAERKRRLPMWFAKGSHTSKKLMDKTKR
GGLFS
Download sequence
Identical sequences ENSMMUP00000029828 9544.ENSMMUP00000029828 ENSMMUP00000029828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]