SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029869 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029869
Domain Number 1 Region: 3-315
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.06e-53
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000144
Further Details:      
 
Domain Number 2 Region: 311-453
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.7e-26
Family Ricin B-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029869   Gene: ENSMMUG00000022690   Transcript: ENSMMUT00000031925
Sequence length 462
Comment pep:known chromosome:MMUL_1:2:158536465:158544550:1 gene:ENSMMUG00000022690 transcript:ENSMMUT00000031925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLQQHPQDSLPTASVILCFHDEAWSILLRTVHSILDTVPRAFLKEIILVDDLSQQGQLKS
ALSEYVARLEGVKLLRSNKRLGAIRARMLGATRATGDVLVFMDAHCECHPGWLEPLLSRI
AGDRSRVVSPVIDVIDWKTFQYYPSKDLQRGVLDWKLDFHWEPLPEHVRKALQSPISPIR
SPVVPGEVVAMDRHYFQNTGAYDPLMSLRGGENLELSFKAWLCGGSVEILPCSRVGHIYR
NQDAPSPVDQEATLRNKVRIAETWLGSFKETFYRHSPEAFSLSKAEKPDCMERLQLQRRL
SCRTFHWFLANVYPELYPSEPRPRFSGKARPLHNTGLGLCADCQAEGNVLDCPMVLAPCS
DSRQQQYLQHTSRKEIHFGRPQHLCFAVRQEQVILQNCTEEGLAIHQQRWDFQENGMIVH
ILSGKCMEAVVQESNKDLYLRPCDGKARQQWRFDQVNAVDER
Download sequence
Identical sequences ENSMMUP00000029872 ENSMMUP00000029869 9544.ENSMMUP00000029872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]