SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029884 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029884
Domain Number 1 Region: 33-197
Classification Level Classification E-value
Superfamily EF-hand 7.94e-47
Family Penta-EF-hand proteins 0.0000000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029884   Gene: ENSMMUG00000022696   Transcript: ENSMMUT00000031940
Sequence length 198
Comment pep:known chromosome:MMUL_1:3:129042976:129057733:1 gene:ENSMMUG00000022696 transcript:ENSMMUT00000031940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQ
SGIAGGYKPFNLETCRLMVSMLDRDMSGKMGFNEFKELWAVLNGWRQHFISFDTDRSGTV
DPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQ
QGVVNFPYDDFIQCVMSV
Download sequence
Identical sequences A0A2I3NBF6 A0A2K5LWP7 A0A2K6BJ41 F7GSM8 G7P1V3
NP_001253145.1.72884 NP_001274256.1.63531 XP_011729004.1.29376 XP_011936838.1.92194 ENSMMUP00000029884 9544.ENSMMUP00000029884 ENSMMUP00000029884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]