SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029897 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029897
Domain Number 1 Region: 152-289
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-26
Family Cadherin 0.0003
Further Details:      
 
Domain Number 2 Region: 269-383
Classification Level Classification E-value
Superfamily Cadherin-like 4e-16
Family Cadherin 0.00046
Further Details:      
 
Domain Number 3 Region: 388-503
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000089
Family Cadherin 0.0036
Further Details:      
 
Domain Number 4 Region: 83-164
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000007
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 524-600
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000981
Family Cadherin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029897   Gene: ENSMMUG00000022704   Transcript: ENSMMUT00000031953
Sequence length 1053
Comment pep:known chromosome:MMUL_1:18:24291456:24329670:1 gene:ENSMMUG00000022704 transcript:ENSMMUT00000031953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEKPKGMDWLVFRNFCLLIVLVVVMEVNSEFIVEVKEFDIENGTTKWQTVRRQKREWIK
FAAACREGEDNSKRNPIAKIRSDCESSQKITYRISGVGIDRPPYGVFTINPRTGEINITS
VVDREITPLFLIYCRALNSRGEDLERPLELRVKVMDINDNAPVFSQSVYTASIEENSDAN
ALVVKLCATDADEENHLNSKIAYKIVSQEPSGAPMFILNRYTGEVCTTSSFLDREQHSMY
NLVVRGSDRDGAADGLSSECDCRIKVLDVNDNFPTLEKTSYSASIEENCLSSELLRLQAI
DLDEEGTDNWLAQYLILSGNDGNWFDIQTDPQTNEGILKVVKMLDYEQAPNIQLSIGVKN
QADFHYSVASQFRMHPTPVRIQVVNVREGPAFHPSTMAFSVREGIKGSSLMNYVLGTYTA
IDLDTGNPATNVRYIIGHDAGSWLKIDSRTGEIQFSREFDTKSKYIINGIYTAEILAIDD
GSGKTATGTICIEVPDINDYCPNIFPERRTICIDSPSVLISVHEHSYGSPFTFCVVDQPP
GTADMWDVRSTNATSAILTARQVLSPGFYEIPILVKDSYNRACELAQMVQLYACDCDDNH
MCLDSGATGIYTEDVTGDTYGPVTEDQAGVSNVGLGPAGIGMMVLGILLLLLAPLLLLLC
CCKQRQPEGLGTRFAPVPEGGEGVMQSWRIEGAHPEDRDVSNICAPMTASNTQDRMDSSE
IYTNTYAAGGTVEGGVSGVELNTGMGTAAGLMAAGAAGAAGVAGAAGAARKRSSTMGTLR
DYADSDVNMAFLDSYFSEKAYAYADEDEGRPANDCLLIYDHEGVGSPVGSIGCCSWIVDD
LDESCMETVDPKFRTLAEICLNTEIEPFPSHQACIPISTDLPLLGPNYFVNESSGLTPSE
AEFQEEVAASEPVVHGDIIVTETYGTADQCVQPTTIIFDPQLAPSVVVTEAVMAPVYDIQ
GNICVPAELADYNNVIYAERVLASPGVPDMSNSSMTDVCMGPVMTGNILVGPEIQVMQMV
SPDLPISQTVDSTSPVTSRHTVTRYGNIHYTQQ
Download sequence
Identical sequences ENSMMUP00000029897 9544.ENSMMUP00000029897 ENSMMUP00000029897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]