SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029970 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029970
Domain Number 1 Region: 40-150
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.17e-17
Family Thyroglobulin type-1 domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029970   Gene: ENSMMUG00000022763   Transcript: ENSMMUT00000032032
Sequence length 323
Comment pep:known chromosome:MMUL_1:1:61430999:61431970:-1 gene:ENSMMUG00000022763 transcript:ENSMMUT00000032032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGPGLAPPPLRLPLLLLLLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGS
GVAVDCSTLTSKCLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCN
QTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLF
RERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRG
GLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGVAVLVISNR
RKSGKYKKVEIKELGELRKEPSL
Download sequence
Identical sequences A0A2K5UE71 F7GC38
9544.ENSMMUP00000029970 ENSMMUP00000029970 ENSMMUP00000029970 XP_001114599.1.72884 XP_005543292.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]