SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030082 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030082
Domain Number 1 Region: 16-261,386-484,529-544
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.16e-45
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000030082
Domain Number - Region: 520-591
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00143
Family WD40-repeat 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030082   Gene: ENSMMUG00000022841   Transcript: ENSMMUT00000032153
Sequence length 686
Comment pep:known chromosome:MMUL_1:20:67508268:67545306:1 gene:ENSMMUG00000022841 transcript:ENSMMUT00000032153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEFKVHRVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEVYNLSANYFQEKFFPGHES
RATEALCWAEGQRLFSAGLNGEIMEYDLQALNIKYAVDVFGGPIWSMAVSPSGSQLLVGC
EDGSVKLFQITPDKIQFERNFDRQKSRILSLSWHPSGTHIAAGSIDYISVFDVKSGSAIH
KMIVDRQHMGVSKRKCIVWGVAFLSDGTVISVDSAGKVQFWDSATGTLVKSHLIANADVQ
SIAVAEQEDSFVVGTAEGTVFHFQLVPVTSNSSEKQWVRTKPFQHHTHDVRTVAHSPTAL
ISGGTDTHLVIRPLMEKVEVKNYDAALRKITFPHRRLISCSKKRQLLLFQFAHHLELWRL
GSTVATGKNGDTLPLSKNADHLLHLKTKGPENIICSCISPCGSWIAYSTVSRFFLYRLNY
EHDNISLKRVSKMPPFLRCALQILFSEDSTKLFVASNQGALHIVQLSGGSFKHLHAFQPQ
SGGNLAQVILPPQPPKYTGACHHTQLKLPLVFVIRSQLHCTVPAYNFPVTAMAIAPNTNN
LVIAHSDQQVFEYSIPDKQYTDWSRTVQKQGFHHLWLQRDTPITHISFHPKRPMHILLHD
AYMFCIIDKSLPLPNDKTLLYNPFPPTNESDVVRRRTAHAFKISKIYKPLLFMDLLDERT
LVAVERPLDDIIAQLPPPIKKKKFGT
Download sequence
Identical sequences 9544.ENSMMUP00000030082 ENSMMUP00000030082 ENSMMUP00000030082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]