SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030094 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030094
Domain Number 1 Region: 179-376
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.91e-35
Family Pentraxin (pentaxin) 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030094   Gene: ENSMMUG00000022850   Transcript: ENSMMUT00000032167
Sequence length 381
Comment pep:known chromosome:MMUL_1:2:130213766:130220403:-1 gene:ENSMMUG00000022850 transcript:ENSMMUT00000032167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCDCRQEHSEWDKLF
TMLENSQMREGMLLQATDDVLRGELQRLREELGRLAESLARPCEQGALAEAKLASALDEL
LQASRDAGRRLERLEGAETQRPEEAGRALAAMLEELRQTRADLHAVQGWAARTWLPAGCD
TAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYL
SYQSIVFVVGGEENKLVAETMVSLGRWTHLCSTWNSEKGLTSLWVNGELVATTVEMATGH
TVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIR
GNIVGWGVTEIQPHGGAQYVS
Download sequence
Identical sequences XP_001103515.1.72884 ENSMMUP00000030094 ENSMMUP00000030094 9544.ENSMMUP00000030094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]