SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030112 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030112
Domain Number 1 Region: 112-342,420-472
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-50
Family Kelch motif 0.007
Further Details:      
 
Domain Number 2 Region: 44-140
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000000301
Family Kelch motif 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030112   Gene: ENSMMUG00000022867   Transcript: ENSMMUT00000032188
Sequence length 522
Comment pep:known chromosome:MMUL_1:20:85845352:85888575:-1 gene:ENSMMUG00000022867 transcript:ENSMMUT00000032188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQALDAKRTQIVETPCPP
PSPRLNASLSVHPEKDELILFGGEYFNSQKTFLYNELYVYNIRKDAWTKVDIPSPPPRRC
AHQAVVVPQGGGQLWVFGGEFASPSGEQFYHYKDLWVLHLATKTWEQVKSTGGPSGRSGH
RMVAWKRQLILFGGFHESTRDYIYYNDVYAFNLDTFTWSKLSPSGTGPTPRSGCQMSVTP
QGGIVIYGGYSKQRVKKDVDKGTRHSDMFLLKPEDGREDKWVWTRMNPSGVKPTPRSGFS
VAMAPNHQTLFFGGVCDEEEEESLAGEFFNDLYFYDATRNRWFEGQLKGPKSEKKKRRRG
RREEPEGGSKLACGGAGTQAPVEVVKEVVTEDGTVVTIKQVLSAPGSAGQPQSEDEDSLE
EAGSPTPGPCPRSNAMLAVKHGVLYVYGGMFEAGDRQVTLSDLHCLDLHRMEAWKALVEM
DPETQEWLEETDSEEDSEEVEGAEGGDEDEDEDSGEESGAED
Download sequence
Identical sequences 9544.ENSMMUP00000032288 ENSMMUP00000032288 ENSMMUP00000030112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]