SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030191 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030191
Domain Number 1 Region: 26-144
Classification Level Classification E-value
Superfamily Translational machinery components 4.38e-17
Family Ribosomal protein L18 and S11 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030191   Gene: ENSMMUG00000022924   Transcript: ENSMMUT00000032268
Sequence length 152
Comment pep:known chromosome:MMUL_1:20:8645914:8646442:1 gene:ENSMMUG00000022924 transcript:ENSMMUT00000032268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGTSKGKEKKEEQIISLGPQVGVGNVFGVCQIFASFIDTLVHVTFVHDLSGKETLCLVIG
GMKVKAGPDESSPYAAMLATQDVAQRCKERGISALHMKLRATGGNKNKTPGPGAQMSLRL
ACSGMKIWQNEYVTPVPSDSTHRKGGVTVVAV
Download sequence
Identical sequences ENSMMUP00000030191 9544.ENSMMUP00000030191 ENSMMUP00000030191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]