SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030238 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030238
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily L domain-like 1.36e-18
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 126-227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000157
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 358-425
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000128
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030238   Gene: ENSMMUG00000022956   Transcript: ENSMMUT00000032317
Sequence length 549
Comment pep:known chromosome:MMUL_1:5:102765853:102771435:1 gene:ENSMMUG00000022956 transcript:ENSMMUT00000032317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLRTLDLHNNKITSVPNEALRYLKNLAYLDLSSNRLTTLPPDFLESWSHLVTTPSGGL
DLSPSRIILGLQDNPWFCDCRISKMIELSKVVDSAIVLLDPLMTCSEPERLTGILFQRAE
LEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQLTWTRSDSSPVNYTVIQESPEEG
VRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVIVTVLGITTTPIPPDTSERPGYHPEW
DAQPGSGRSTSSTSSYPWSSSFSPTSSFSASTLSPPSTASFSLSPFFSSTVSSITTLSTS
ISATTMANKQSFQLHPDGKRNLKAAKSGSKLPPASTRKKEELALLDHTMLTETNATIENL
RVVSETKESVTLTWNMINTTHNSAVTVLYSKYGGKDLLLLNADSSKNQVTIDGLEPGGQY
MACVCPKGVPPQKDQCITFSTETVEGDDSQWSLLLVVTSTACVVVLLLICFLLYKVCKLQ
CKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTRSHRDDSEKLLLCSRSSVESQVTFKS
ESSRPEHYC
Download sequence
Identical sequences 9544.ENSMMUP00000034897 ENSMMUP00000034897 ENSMMUP00000030238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]