SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030275 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030275
Domain Number 1 Region: 539-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000209
Family TSP-1 type 1 repeat 0.00091
Further Details:      
 
Domain Number 2 Region: 74-142,193-206,492-530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000675
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 37-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000030275
Domain Number - Region: 351-391
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0575
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030275   Gene: ENSMMUG00000022992   Transcript: ENSMMUT00000032357
Sequence length 584
Comment pep:known chromosome:MMUL_1:1:59722525:59785316:1 gene:ENSMMUG00000022992 transcript:ENSMMUT00000032357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKRYRY
RSLLQPNKFGGTICSGDVWDQASCSSSTPCIRQARCGQDFQCKETGRCLKRHLVCNGDQD
CLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDATYYGGQCETV
YNGEWRELRYDPTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSELYDNANDLLSKV
RKDKSDSFGVTIGIGPAGSPLMVGVGVSKSEDASFLKELNKYNEKKFIFMRIFTKVQTAH
FKMRRDNIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGTYEYILVIDKA
KMESLGITSRDIMTCFGGSLGIQYEGGINVDGSLSGDHCKKFGDGKTGKARKAMAVEDII
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLRHALDQYLTEFNACRCGPCFNNGVPILEGTSCRCQCRLGRLGPACEQIQTEGAKADG
SWSCWSSWSVCRTGTQERRRECDNPAPQNGGASCPGRKVQTQAC
Download sequence
Identical sequences ENSMMUP00000030275 ENSMMUP00000030275 9544.ENSMMUP00000030275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]