SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030304 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030304
Domain Number 1 Region: 234-346
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 0.0000000000301
Family Nucleoside diphosphate kinase, NDK 0.0044
Further Details:      
 
Domain Number 2 Region: 37-124
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 0.00000693
Family C-terminal domain of adenylylcyclase associated protein 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030304   Gene: ENSMMUG00000023018   Transcript: ENSMMUT00000032389
Sequence length 350
Comment pep:known chromosome:MMUL_1:X:44670045:44712110:1 gene:ENSMMUG00000023018 transcript:ENSMMUT00000032389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQ
QFLIQDCENCNIYIFDHSATITIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVR
DCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPV
SGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVL
FAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLVNKGPVIAL
EFNGDGAVEGCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGN
Download sequence
Identical sequences 9544.ENSMMUP00000030304 ENSMMUP00000030304 ENSMMUP00000030304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]