SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030348 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030348
Domain Number 1 Region: 434-635
Classification Level Classification E-value
Superfamily Fibronectin type III 6.61e-40
Family Fibronectin type III 0.00063
Further Details:      
 
Domain Number 2 Region: 235-425
Classification Level Classification E-value
Superfamily Fibronectin type III 1.8e-35
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 105-200
Classification Level Classification E-value
Superfamily Fibronectin type III 4.97e-23
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 1079-1167
Classification Level Classification E-value
Superfamily Immunoglobulin 6.67e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 8-100
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000132
Family I set domains 0.026
Further Details:      
 
Domain Number 6 Region: 859-928,981-1034
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000037
Family I set domains 0.073
Further Details:      
 
Domain Number 7 Region: 742-828
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000546
Family I set domains 0.049
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000030348
Domain Number - Region: 652-722
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000812
Family I set domains 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030348   Gene: ENSMMUG00000023052   Transcript: ENSMMUT00000032435
Sequence length 1175
Comment pep:known chromosome:MMUL_1:1:26696505:26736740:-1 gene:ENSMMUG00000023052 transcript:ENSMMUT00000032435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGRLLRSSRRRKILYAD
CQASLKVSCTYKEDEGLYTVQVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVN
RDCLILTWAPPSDTRGNAITAYSIERCQGDSGEWVPCHEAPGGTCRCPIQGLVEGQSYRF
RVRAISKAGSSLPSKASELVVMGDHDAARRKTEIPFGLGNKITISTDDFEDTVTIPSPPT
NVHASEIREAYVVLAWEEPRPRGRAPLTYSLEKSVIGSGTWEAISTESPVKSPRFAVLDL
EKKKSYVFRVRAMNQYGLSDPSEPSEPIALPGQPATLPPPAQVQAFRDTQTSVTLTWDPV
KDPELLGYYIYSREVGSSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESS
AATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELD
WHAVNQQPIPTRVCKVSDLREGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPP
YDVRVSEVRATSLVLQWEPPLYTGAGPVTGYHISFQEEGSEQWKPVTPGPISGTHLRVSD
LQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAP
DSSEFQWSKDYKGPLDPQRVTIEDTVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHT
LTEEELEKLKKLSHEIRNPVIKLISGWNVDILERGEVRLWLEVEKLSPAAELHLIFNNKE
IFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLR
QADAKRRDWKRKQGPYFEQPLQWKVTEDCQVQLTCKASVTNTKKETRFQWFFQRAELPDG
QYDPETGTGLLCIEEASLSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGA
LSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHIL
DPKDSDKGKYTLEIAAGKEFRQLSTDLSGQAFEDAMAEHQRLKFLYVSQYRAKVVRGLPD
VATIMEDKTLCLTCVISGDPTPEISWLKNDQPVTFLDRYRMEVRGSEVTITIEKVNSDDS
GRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM
Download sequence
Identical sequences ENSMMUP00000030348 ENSMMUP00000030348 9544.ENSMMUP00000030348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]