SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030393 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030393
Domain Number 1 Region: 122-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.59e-27
Family Nucleotide and nucleoside kinases 0.00000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030393   Gene: ENSMMUG00000023085   Transcript: ENSMMUT00000032480
Sequence length 285
Comment pep:known chromosome:MMUL_1:1:142233403:142241367:-1 gene:ENSMMUG00000023085 transcript:ENSMMUT00000032480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGSRKEEILPPEQLVPFQESGCWGSMGAQSRERSGRDHSGTWICAGGSQETFHLGAPVE
TTCLAASSLTPRHVRPQACGAEWAFGSWEEHPAEEAAPGAQRHLWLQRVPYHKEPEAWRG
EWQREVMQRDIAAGDFIEHAEFSGNLYGTSKAAVQAVQAMNRICVLDVDLQGVRNIKATD
LRPIYISVQPPSLHVLEQRLRQRNTETEESLAKRLAAARADMESRNQESSKDRRLRLALC
SRHPRPIQDQGSSTEPPPLAGRQLCALGQHMEWRGCCPCGWNILG
Download sequence
Identical sequences ENSMMUP00000038468 9544.ENSMMUP00000038468 ENSMMUP00000030393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]