SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030455 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030455
Domain Number 1 Region: 59-190
Classification Level Classification E-value
Superfamily Bromodomain 4.71e-42
Family Bromodomain 0.00023
Further Details:      
 
Domain Number 2 Region: 329-459
Classification Level Classification E-value
Superfamily Bromodomain 8.24e-42
Family Bromodomain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030455   Gene: ENSMMUG00000023138   Transcript: ENSMMUT00000032547
Sequence length 837
Comment pep:known chromosome:MMUL_1:4:32676531:32689232:1 gene:ENSMMUG00000023138 transcript:ENSMMUT00000032547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPAN
PPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQP
MDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASM
PQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHAALYTPPPEIPTTVLNI
PHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPA
SPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKEL
LSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL
MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSES
SSEESSSESSSEEEEEEDEDDEEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQ
GPISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAA
LGPSGFGPSGGSGTKLGTGVQWHHLGSWQPPLLGIKRFCLSLPNSWDYRLAPPSPANFSP
PALPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGEKLGRVVHIIQAREPSLRDSNPEEI
EIDFETLKPSTLRELERYVLSCLRKKPRKPYTIKKPVGKTKEELALEKKRELEKRLQDVS
GQLNSTKKPPKKVNEKTESSSAQQVAVSRLSASSSSSDSSSSSSSSSSSDTSDSDSG
Download sequence
Identical sequences ENSMMUP00000030455 ENSMMUP00000033922 9544.ENSMMUP00000033922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]