SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030495 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000030495
Domain Number - Region: 134-186
Classification Level Classification E-value
Superfamily NTF2-like 0.00193
Family TIM44-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030495   Gene: ENSMMUG00000023168   Transcript: ENSMMUT00000032588
Sequence length 291
Comment pep:known chromosome:MMUL_1:12:63551775:63560687:1 gene:ENSMMUG00000023168 transcript:ENSMMUT00000032588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAAGLLPQLRHSGSLPCGAVRLRTLAAAEVRLPSARLCYLCRCRLGSGAASFPRSAWA
LAASALPAQGSRRPVLSRPGLPTAFASFPACLQRSYSTEEKPQQHQKTKMIVLGFSNPIN
WVRTRIKAFLIWAYFDKEFSIAEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHVLK
EKVTSLPDNHKNALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETL
RGASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE
Download sequence
Identical sequences ENSMMUP00000030495 NP_001180825.1.72884 ENSMMUP00000030495 9544.ENSMMUP00000030495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]