SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030541 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030541
Domain Number 1 Region: 47-112
Classification Level Classification E-value
Superfamily SNARE fusion complex 3.56e-23
Family SNARE fusion complex 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030541   Gene: ENSMMUG00000023203   Transcript: ENSMMUT00000032639
Sequence length 140
Comment pep:known chromosome:MMUL_1:1:201397009:201434498:-1 gene:ENSMMUG00000023203 transcript:ENSMMUT00000032639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVD
EVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMA
LVAAILLLVIIILIVMKYRT
Download sequence
Identical sequences A0A2J8LLI9 A0A2J8UBR0
ENSP00000356714 NP_001172056.1.87134 NP_001172056.1.92137 XP_011855833.1.47321 XP_012366462.1.23891 ENSMMUP00000030541 ENSMMUP00000030541 ENSP00000356714 ENSP00000415627 gi|297591831|ref|NP_001172056.1| 9544.ENSMMUP00000030541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]