SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030586 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030586
Domain Number 1 Region: 626-868
Classification Level Classification E-value
Superfamily vWA-like 3.17e-76
Family Trunk domain of Sec23/24 0.00000592
Further Details:      
 
Domain Number 2 Region: 408-544,869-963
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 3.01e-70
Family beta-sandwich domain of Sec23/24 0.00048
Further Details:      
 
Domain Number 3 Region: 1070-1218
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.49e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.002
Further Details:      
 
Domain Number 4 Region: 965-1069
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 3.79e-29
Family Helical domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 5 Region: 543-625
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.83e-23
Family Zn-finger domain of Sec23/24 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030586   Gene: ENSMMUG00000023240   Transcript: ENSMMUT00000032687
Sequence length 1219
Comment pep:known chromosome:MMUL_1:5:102400001:102476285:1 gene:ENSMMUG00000023240 transcript:ENSMMUT00000032687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPAQNQMQVPSGYGLHHQNYIAPSGHYSQGPGKMTSLPLDTQCGDYYSALYTVPTQNVTV
NTVNQQPGAQQMYSRGPPAPHIVGSTLGSFQGAASSASHLHTSASQPYSSFVNHYNSPAM
YSANSSVASQGFPSTCGHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQSAPTIRPVKD
NSFSGQNTAISHPLPLPPPPSQQHQQQQSLSGYNTLTWSAPGLPSTQDNLIRNHTGSLAV
ANNNPTITGKYSLSCPVMQNVQPPKSSPVVSTVLSGSSSTRTPPTANHPVEPVTSVTQPS
ELLQQKGMQYGEYVNNQASSAPTPLSSTSDDEEEEEEDEEAGVDSSSTTSSASPMPNSYD
ALEGGSYPDMLSSSASSPAPDPAPEPDPASASAPASAVAPVIPQPSKMAKPAMAIQHFSL
VIRMLQHHLLLEYSPNPVYSGFQQYPQQYPGVNQLSSSLGGLSLQSSPQPESLRPVNLTQ
ERNILPMTPVWAPVPNLNADLKKLNCSPDSFRCTLTNIPQTQALLNKAKLPLGLLLHPFR
DLTQLPVITSNTIVRCRSCRTYINPFVSFIDQRRWKCNLCYRVNDVPEEFMYNPLTRSYG
EPHKRPEVQNSTVEFIASSDYMLRPPQPAVYLFVLDVSHNAVEAGYLTILCQSLLENLDK
LPGDSRTKIGFMTFDSTIHFYNLQEGLSQPQMLIVSDIDDVFLPTPDSLLVNLYESKELI
KDLLNALPNMFTNTRETHSALGPALQAAFKLMSPTGGRVSVFQTQLPSLGAGLLQSREDP
NQRSSTKVVQHLGPATDFYKKLALDCSGQQTAVDLFLLSSQYSDLASLACMSKYSAGCIY
YYPSFHYTHNPSQAEKLQKDLKRYLTRKIGFEAVMRIRCTKGLSMHTFHGNFFVRSTDLL
SLANINPDAGFAVQLSIEESLTDTSLVCFQTALLYTSSKGERRIRVHTLCLPVVSSLADV
YAGVDVQAAICLLANMAVDRSISSSLSDARDALVNAVVDSLSAYGSTVSNLQHSALMAPS
SLKLFPLYVLALLKQKAFRTGTSTRLDDRVYAMCQIKSQPLVHLMRMIHPNLYRIDRLTD
EGAIHVNDRVVPQPPLQKLSAEKLTREGAFLMDCGSVFYIWVGKGCDNNFIEDVLGYPNF
ASIPQKMTHLPELDTLSSERARSFITWLRDSRPLSPILHIVKDESPAKAEFFQHLIEDRT
EAAFSYYEFLLHVQQQICK
Download sequence
Identical sequences ENSMMUP00000030586 9544.ENSMMUP00000030586 ENSMMUP00000030586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]