SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030670 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030670
Domain Number 1 Region: 127-267
Classification Level Classification E-value
Superfamily Second domain of FERM 6.02e-16
Family Second domain of FERM 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030670   Gene: ENSMMUG00000023300   Transcript: ENSMMUT00000032778
Sequence length 464
Comment pep:known chromosome:MMUL_1:14:9023691:9046945:-1 gene:ENSMMUG00000023300 transcript:ENSMMUT00000032778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGTEGSTGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRA
VREVLQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDE
PFLQFRRNVFFPKRRELQIRDEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQL
GPYQPGQPAACALREKLDSFLPAHLCKRGQGLFAALRGRGTRAGPGEQGLLNAYRQVQEV
GSDGGCEAALGTHYRAYLFKCHELPFYGCAFFHGEVDKPAQGFLHRGGRKPVSVAISLEG
VHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAEL
MSSLIEYCIELSQVAEPAGPQDSATGPPSDPSSSPAPVERPKLRRQGSVVSSRIQHLSTI
DYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPSDSLEQG
Download sequence
Identical sequences A0A1D5QDW9 A0A2K5V7G0
ENSMMUP00000030670 9544.ENSMMUP00000030670 NP_001247833.1.72884 XP_005577334.1.63531 ENSMMUP00000030670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]