SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030675 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030675
Domain Number 1 Region: 7-100
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 3.01e-33
Family Cytochrome b5 0.00000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030675   Gene: ENSMMUG00000013607   Transcript: ENSMMUT00000032783
Sequence length 134
Comment pep:known chromosome:MMUL_1:18:67733111:67774865:-1 gene:ENSMMUG00000013607 transcript:ENSMMUT00000032783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDAT
ENFEDVGHSTDAREMSKTYIIGELHPDDRPKLSKPPETLITTVDSSSSWWTNWVIPAISA
VAVALMYRLYMAED
Download sequence
Identical sequences A0A1D5Q2B7 A0A2K5M4W9
9544.ENSMMUP00000030675 NP_001253202.1.72884 XP_011938899.1.92194 ENSMMUP00000030675 ENSMMUP00000030675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]