SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030737 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030737
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.66e-18
Family Nucleoplasmin-like core domain 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000030737
Domain Number - Region: 143-223
Classification Level Classification E-value
Superfamily HRDC-like 0.017
Family RNA polymerase II subunit RBP4 (RpoF) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030737   Gene: ENSMMUG00000017463   Transcript: ENSMMUT00000032851
Sequence length 227
Comment pep:known chromosome:MMUL_1:11:77971236:77971919:-1 gene:ENSMMUG00000017463 transcript:ENSMMUT00000032851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESED
EEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEDDDDEDDDDDDFDDEEAE
EKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDI
KAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Download sequence
Identical sequences ENSMMUP00000030737 9544.ENSMMUP00000030737 ENSMMUP00000030737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]