SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030771 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030771
Domain Number 1 Region: 83-154
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.93e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030771   Gene: ENSMMUG00000023375   Transcript: ENSMMUT00000032888
Sequence length 910
Comment pep:known chromosome:MMUL_1:16:17716474:17724076:-1 gene:ENSMMUG00000023375 transcript:ENSMMUT00000032888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLQPHFIKADSLLLTAMKTDGTTVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLV
VDADKLPINRLAAGSKAPGSAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKL
NKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSEGNTDVLMEGV
KTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSP
HSRGMLDRSRLALCTLVFLCLSCNPLASLLGARGLPGPSDITSVYHSPGRNVLGTESRDG
PGWAQWLLPPVVWLLNGLLVLVSLVLLFVYGEPVTRPHSGPAVHFWRHRKQADLDLARGD
FAQAAQQLWLALRALGRPLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLQRDCS
LRVDARASARDAALVYHKLHQLHTMGKYTGGHLTATNLALSALNLAECAGDAVSVATLAE
IYVAAALRVKTSLPRTLHFLTRFFLSSARQACLAQSGSVPPAMQWLCHPVGHRFFVDGDW
AVLSTPRETLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDAL
GYLQLLNSCSDAAGAPACSFSISSSMATTTGIDPVAKWWASLTAVVIHWLRRDEEAAERL
CPLVEHLPRVLQESERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASGYLQDSLA
TTPASSSIDKAVQLFLCDLLLVVRTSLWRQQQPPAPAPAAQGTSSGPLVSALELRGFQRD
LSSLRRLAQSFRPAMRRVFLHEATARLMAGASPTRTHQLLDRSLRRRAGPGGKGGAVAEL
EPRPTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLEKLGDRRLLHDCQQMLMR
LGGGTTVTSS
Download sequence
Identical sequences 9544.ENSMMUP00000012722 ENSMMUP00000012722 ENSMMUP00000030771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]