SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030804 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030804
Domain Number 1 Region: 79-240
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-28
Family Trypanosoma sialidase, C-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030804   Gene: ENSMMUG00000023398   Transcript: ENSMMUT00000032922
Sequence length 1604
Comment pep:known chromosome:MMUL_1:1:34409455:34455707:-1 gene:ENSMMUG00000023398 transcript:ENSMMUT00000032922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVSWAPGLWLLGLWATFSHGANTGAHCPPSQQEGLKLEHSSSLPANVTGFNLIRRLSLM
KMSAIKKIRNPKGPLILRLGAASVTQPTRRVFPRGLPEEFALVLTLLLKKHTHQKTWYLF
QVTDADGYPQISLEVNNQERSLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVA
SVHVDCSSASSQPLGPRRPLRPVGHVFLGLDAEQGKPVSFDLQQVHIYCDPELVLEEGCC
EILPAGCPPETSKARRDTQSNELIEINPQSEGKVYTRCFCLEEPQNSQVDAQLTGRINQK
AERGAKVHRETAADECPPCVHGAQDSNVKLPRGSHGGKGERGLPGPPGSKGEKGARGNDC
VLISPDAPLQCAEGPKGEKGQSGALGPSGLPGSTGEKGQKGEKGDGGLKGVPGKPGRDGR
PGEICVIGPKGQKGDPGFVGPEGLAGEPGPPGLPGPPGIGLPGTPGDPGGPPGPKGDKGS
SGIPGKEGPGGKPGKPGVKGEKGDPCEVCPTLPEGFQSFVGLPGKPGPKGEPGDPVSARG
DPGIQGIKGEKGESCLSCSSVVGAQHLASSTGASGDVGSPGFGLPGLPVKAGVPGLLGEV
GGNFGEAGPAGSPGPPGPVGPVGIKGAKGEPCEPCPALSNLQDGDVRVVALPGPSGEKGE
PGPPGFGLPGKQGKAGERGLKGQKGDAGNPGDPGTPGTTGRPGLSGEPGVRGPAGPKGEK
GDGCTACPSLQGTVTDVAGRPGQPGPKGEPGPEGVGRPGKPGQPGLPGVQGPPGLKGMQG
EPGPPGRGVQGPQGEPGAPGLPGIQGLPGPRGPPGPTGEKGTQGSPGVKGATGPVGPPGT
SVSGPPGRDGQQGQTGPRGTPGEKGPRGEKGEPGECSCPSRGDLVFSGMPGAPGLWMGSS
WQPGPQGPPGIPGPPGPPGVPGLQGVPGNNGLPGQPGLTAELGRLRGREPRLWSICGDCV
QGQRAHPAYLVEKGEKGDQGIPGVLGLDNCAQCFLSLERPRAEEARGDNNEGDPGCIGSP
GLPGPPGLPGQRGEEGPPGMRGSPGPPGPIGPPGFPGAVGSPGLPGLQGERGLTGLTGDK
GEPGPPGQPGYPGAMGPPGLPGIKGERGYTGSAGEKGEPGPPGSEGLPGPPGPAGPRGER
GPQGNSGEKGDQGFQGQPGFPGPPGPPGFPGKVGAPGPPGPQAEKGSEGIRGPSGMPGSP
GPPGPPGIQGPAGLDGLDGKDGKPGLRGDPGPAGPPGLMGPPGFKGKTGHPGLPGPKGDC
GKPGPPGSTGRPGAEGEPGAMGPQGRPGPPGHVGPPGPPGQPGPAGISAVGLKGDRGATG
ERGLAGLPGQPGPPGHPGPPGEPGTDGAAGKEGPPGKQGLYGPPGPKGDPGAAGQKGQAG
EKGRAGMPGGPGKSGSMGPVGPPGPAGERGHPGAPGPSGSPGLPGVPGSMGDMVNYDEIK
RFIRQEIIKMFDERMAYYTSRMQFPMEMAAAPGRPGPPGKDGAPGRPGAPGSPGLPGQIG
REGRQGLPGMRGLPGTKGEKGDIGVGIAGENGLPGPPGPQGPPGYGKMGATGPMGQQGIP
GIPGPPGPMGQPGKAGHCSPSDCFGAMPMEQQYPPMKTMKGPFG
Download sequence
Identical sequences ENSMMUP00000030804 ENSMMUP00000030805 9544.ENSMMUP00000030805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]