SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030842 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030842
Domain Number 1 Region: 417-559
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-23
Family MAM domain 0.0009
Further Details:      
 
Domain Number 2 Region: 156-255
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000942
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 44-180
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000235
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030842   Gene: ENSMMUG00000023428   Transcript: ENSMMUT00000032961
Sequence length 563
Comment pep:known chromosome:MMUL_1:5:98944618:99016281:1 gene:ENSMMUG00000023428 transcript:ENSMMUT00000032961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLLALVLVSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPRCKHGDCIGPNKCKCHPGYAGKTCNQDLNECGLMPRPCKHRCMNTYGSYKCYCLNGYM
LMPDGSCSSALTCSMANCQYGCDVVKGQIRCQCPSPGLQLAPDGRTCVDVDECATGRASC
PRFRQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNIHGSYKC
KCKEGYQGDGLTCVYIPKVMIEPSSPIHVPKGNGTILKGDGGHNNRIPDVGSTWWPPKTA
YIPPIITDRPTSKPTTRPTPKPTPLPTPPPPLPTELRTPLPATTPERPTTRLTTIAPAAS
TPPGGITVDNRVQIDPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVLVHSC
NFDHGLCGWIREKDNDLHWEPIRDPAGGQYLTVSAAKAPGGKAARLVLPLGRLMHSGDLC
LSFRHKVTGLHSGTLQVFVRKHSAHGAALWGRNGGHGWRQTQITLRGADIKSVIFKGEKR
RGYTGEIGLDDVSLKKGPCSEER
Download sequence
Identical sequences XP_001085018.1.72884 ENSMMUP00000030842 ENSMMUP00000034914 9544.ENSMMUP00000034914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]