SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030884 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030884
Domain Number 1 Region: 414-491
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0000000000000173
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030884   Gene: ENSMMUG00000023455   Transcript: ENSMMUT00000033005
Sequence length 517
Comment pep:known chromosome:MMUL_1:7:50889122:50915035:-1 gene:ENSMMUG00000023455 transcript:ENSMMUT00000033005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEIYSENSVSIREY
GTIDDVDIDLHINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNK
EGFGLGLQLKKQSLGWNTSFQKCLSEICPGKAKINLGSFKASGTIKKFRAGLSIFSPIPK
SPSFPIIQDSMLKGKLGVPELRVGRLMNRSISCTMKNPKVEVFGYPPSPQAGLLCPQHVG
LPPPARTSPLVSGHCKNIPTLEYGFLVQIMKYAEQRIPTLNEYCVVCDEQHVFQNGSMLK
PAVCTRELCVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAALESPRKSIIFEPYPSVV
DPTDPKTLAFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKKQMDKLDPLAHPLLQWII
SSNRSHIVKLPLSRQLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENWH
SILRNGLVNASYTKLQEWEKDSTGCPPRMSWSRDITG
Download sequence
Identical sequences ENSMMUP00000030884 9544.ENSMMUP00000030884 ENSMMUP00000030884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]