SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030958 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030958
Domain Number 1 Region: 275-520
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-43
Family Kelch motif 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030958   Gene: ENSMMUG00000023521   Transcript: ENSMMUT00000033085
Sequence length 559
Comment pep:known chromosome:MMUL_1:1:21126522:21128960:1 gene:ENSMMUG00000023521 transcript:ENSMMUT00000033085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQSWVFTRVIGVSREEPGALQAASDVGLTLHQQEGAPNASYTFSSIARVRMEENFIQKV
EGVEPRLKGKVYDYYVESTSQAIFQGRLAPRTAALTEVPSPRTPPGSLGTGAASGGQAGD
TKGAAERAASPHSGPSPSNRGFSRKESLLQIAENPELQLQPDGFRLPAPPCPDPGALPDS
DRSSREPHVHLVAGTNFFHVPLTPASAPQVRLDLGNCYEVLTLAKRHNLESLKEAAYKVM
SENYLQVLRSPDIYGCLSGAERQLILQRRLQGRQYLVVADVCPKEDSGGLCCYDDEQDVW
RPLARLPPEAVSRGCAICSLFNYLFVVSGCQGPGHQPSSRVFCYNPLTGIWSEVCPLNQA
RPHCRLVALDGHLYAIGGECLNSVERYDPRLDRWDFVPPLPSDTFALAHTATACAKEIFV
TGGSLRFLLLRFSAQEQRWWACPTGGSKDRTAEMVAVNGFLYRFDLNRSLGIAVYRCSAS
TRLWYECATYRTPYPDAFQCTVVDNLIYCVGRRSTLCFLADSVSPRFVPKELQSFPAPQG
TLLPTVLTLPTPDLPQTRV
Download sequence
Identical sequences 9544.ENSMMUP00000030958 ENSMMUP00000030958 ENSMMUP00000030958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]