SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031067 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031067
Domain Number 1 Region: 140-266
Classification Level Classification E-value
Superfamily PX domain 1.57e-31
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 303-430,457-519
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000349
Family BAR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031067   Gene: ENSMMUG00000023598   Transcript: ENSMMUT00000033198
Sequence length 523
Comment pep:known chromosome:MMUL_1:6:119172927:119226796:1 gene:ENSMMUG00000023598 transcript:ENSMMUT00000033198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEREPPPLGDGKPTDFEDLEDGEDLFTSTVSTLESSPSSPEPASLPAEDISANSNGPK
PTEVGLDDDREDLFAEATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSA
PVIFDRSREEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSV
KRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALE
RYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMN
ESDAWFEEKQQQFENLDQQLRKLHASVEALVCHRKELSANTAAFAKSAAMLGNSEDHTAL
SRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDA
QITLLKKREAEAKMMVANKPDKIQQAKNEIREEIEEWEAKVQQGERDFEQISKTIRKEVG
RFEKERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA
Download sequence
Identical sequences F7CPF6 P0C220
ENSMMUP00000031067 9544.ENSMMUP00000034209 NP_001271755.1.63531 XP_011708395.1.29376 XP_011843167.1.47321 XP_011945452.1.92194 ENSMMUP00000034209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]