SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031117 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031117
Domain Number 1 Region: 3-382
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.7e-97
Family Regulator of chromosome condensation RCC1 0.00000000000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031117   Gene: ENSMMUG00000023637   Transcript: ENSMMUT00000033252
Sequence length 385
Comment pep:known chromosome:MMUL_1:9:48758281:48759417:-1 gene:ENSMMUG00000023637 transcript:ENSMMUT00000033252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSHRSHSTEPSLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSK
SGQVYSFGCNDEGALGRDTSVKGSEMIPGKVELQEKVVQVSAGDSHTAALTEDGHVFLWG
SFWDNNGVIGLLEPMKKSMVPVQVPVVKVASGNDDLVVLTADGDLYTLGCGEQGQLGCVP
ELFANRGGRQSLEMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPD
TESCFILQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGQAEYGRLGLGEGAEEKS
IPTLISRLPAVSSVACGASVGYAVTKDGCVFAWGMGTNYQLGTGQDEDSWSPVEMRGKQL
ENHVVLSVSSGGQHTVLLVKDKEQS
Download sequence
Identical sequences 9544.ENSMMUP00000031118 ENSMMUP00000031117 ENSMMUP00000031118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]